PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G122800.1.p
Common NameLOC101758820, SETIT_016959mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 507aa    MW: 55569.3 Da    PI: 8.0489
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G122800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR41.33.1e-1366103139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         k+kk+CnC++skClk+YCeCf++ ++C+  C+C++C N 
  Seita.1G122800.1.p  66 KKKKHCNCRNSKCLKMYCECFQELQFCDG-CNCSNCGNI 103
                         589**************************.******996 PP

2TCR49.77.4e-16151190140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k++kgC+Ckks ClkkYCeC++a++ Cs++C+C dCkN e
  Seita.1G122800.1.p 151 KHNKGCHCKKSGCLKKYCECYQANVLCSKNCRCMDCKNFE 190
                         589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-1166106IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.30367191IPR005172CRC domain
PfamPF036381.1E-968102IPR005172CRC domain
SMARTSM011142.0E-18151192IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.2E-12154189IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MEQGRNQQHP QQQQPKPAIL APVGEMKAPA VAPQQPKPPA PAMPVPRQWP MAIKPPSTEA  60
KTVTPKKKKH CNCRNSKCLK MYCECFQELQ FCDGCNCSNC GNIVGNEKAR NEAMEAIRQR  120
NPLAFQPKIE NGPSTHNVRK DTSGAVPLVP KHNKGCHCKK SGCLKKYCEC YQANVLCSKN  180
CRCMDCKNFE GSEERKALVQ GDYASDGNKT QQAARVAING TIGSSGYNHS PVRRKRSRED  240
AVGIRINSEG SMPETQFQQG NHADTSLLAP YSTGFDGHSA ANSQSKSYNP IYRSPLANTI  300
HLSEVNDLVT QLVTVCRMAA ATIADNKVDG TTVEKEFHVN GELSNGNCKQ QQLSEASRMD  360
ILTRGCSDPP NSNEMDSHWS DTAKDSRPAS PTTQALMCDE QDTTFGNDYR SSYPSVSCDQ  420
DISEINAAQE NLVLTGLREY LRVIITRGKI NEHKSSSEAA MELDGRQHGA MPAFAPREVR  480
ENIPSSNGIE TPGINQKLTH DDGSKR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952204.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLK3YRR50.0K3YRR5_SETIT; Uncharacterized protein
STRINGSi016959m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57552653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.12e-94Tesmin/TSO1-like CXC domain-containing protein